Copyright © Philip M. Parker, INSEAD. Terms of Use.

Erratic

Definitions: Erratic

Erratic

Adjective

1. Having no fixed course; "an erratic comet"; "his life followed a wandering course"; "a planetary vagabond".

2. Liable to sudden unpredictable change; "erratic behavior"; "fickle weather"; "mercurial twists of temperament"; "a quicksilver character, cool and willful at one moment, utterly fragile the next".

3. Likely to perform unpredictably; "erratic winds are the bane of a sailor"; "a temperamental motor; sometimes it would start and sometimes it wouldn't"; "that beautiful but temperamental instrument the flute"- Osbert Lancaster.

Source: WordNet 1.7.1 Copyright © 2001 by Princeton University. All rights reserved.
 

Date "erratic" was first used in popular English literature: sometime before 1827. (references)

 

Specialty Definitions: Erratic

DomainDefinitions

19th Century Satire

Full of mistakes. Source: Foolish Dictionary, 1904.

Geography

Rock fragment carried by glacial ice or by floating ice, deposited at some distance from the outcrop from which it was derived and generally, though not necessarily, resting on bedrock of different lithology. Source: European Union. (references)
 Are boulders on the surface at points far distant from their source rocks. Source: European Union. (references)

Language

Deviating from the conventional or usual course; queer; eccentric. Source: European Union. (references)
 Wandring; having no certain course; . . . irregular. . . . devia deviating from the conventional or usual course; queer; eccentric. Source: European Union. (references)
 Wandering; having no certain course; . . . irregular. Source: European Union. (references)

Mining

A rock fragment carried by glacial ice or by floating ice, deposited at some distance from the outcrop from which it was derived, and generally though not necessarily resting on bedrock of different lithology. Sizeranges from a pebble to a house-size block. (references)

Source: compiled by the editor from various references; see credits.

Top     

Synonyms: Erratic

Synonyms: fickle (adj), mercurial (adj), planetary (adj), quicksilver(a) (adj), temperamental (adj), wandering (adj). (additional references)

Top     

Synonyms within Context: Erratic

ContextSynonyms within Context (source: adapted from Roget's Thesaurus).

Caprice

Adjective: capricious; erratic, eccentric, fitful, hysterical; full of whims; Noun: maggoty; inconsistent, fanciful, fantastic, whimsical, crotchety, kinky, particular, humorsome, freakish, skittish, wanton, wayward; contrary; captious; arbitrary; unconformable; penny wise and pound foolish; fickle; (irresolute); frivolous, sleeveless, giddy, volatile.

Changeableness

Unstaid, inconstant; unsteady, unstable, unfixed, unsettled; fluctuating; Verb: restless; agitated; erratic, fickle; irresolute; capricious; touch and go; inconsonant, fitful, spasmodic; vibratory; vagrant, wayward; desultory; afloat; alternating; alterable, plastic, mobile; transient; wavering.

Deviation

Adjective: deviating; Verb: aberrant, errant; excursive, discursive; devious, desultory, loose; rambling; stray, erratic, vagrant, undirected, circuitous, indirect, zigzag; crab-like.

Motion

Adjective: moving; Verb: in motion; transitional; motory, motive; shifting, movable, mobile, mercurial, unquiet; restless; (changeable); nomadic; erratic.

Source: adapted from Roget's Thesaurus.

Top     

Crosswords: Erratic

English words defined with "erratic": disorganized schizophrenia, disorganized type schizophreniaEccentric strap, Errabund, Erratic phenomena, Erratical, erraticallyficklehebephrenia, hebephrenic schizophreniaInerraticjumping bristletailmachilidplanetaryswerveunpredictablyvolatilewanderingyaw. (references)
Specialty definitions using "erratic": boulder stonecrazydawgdrift velocityerratic block, erratic boulder, erratic errorfalse beddingGiardia lamblia, glacial erraticPeppy Baprandom error. (references)

Top     

Commercial Usage: Erratic

DomainTitle

Books

  • Crime & Politics: Big Government's Erratic Campaign for Law and Order (reference)

  • Erratic Behaviour of Tides (reference)

  • Erratic Signals: Worldwide Handset Market Forecast and Analysis, 2000-2005 [DOWNLOAD: PDF] (reference)

  • Erratic Sleep in a Cold Hotel (reference)

  • Sailing South: The Erratic Adventures of the Irish Dragoon (reference)

    (more book examples)

Source: compiled by the editor from various references; see credits.

Top     

Photo Album: Erratic

ThumbnailDescription & CreditThumbnailDescription & Credit

Glacial erratic boulder (white boulder in left center) trapped on eroding granite shoreline.Credit: America's Coastlines.

Japanese aircraft carrier Shokaku attacked by USS Yorktown (CV-5) planes, during the morning of 8 May 1942. Flames from a bomb hit on her forecastle are visible, as are smoke and splashes from dive bombers' near misses off her starboard side. Photographed from a Torpedo Squadron Five TBD-1. What appear to be erratic torpedo tracks are visible in the lower left.Credit: NAVY.

Source: compiled by the editor from various references; see credits.

Top     

Sounds Captioned with "Erratic".

PlayCaption
Amusing; arbitrary; capricious; chancy; chimerical; comical; curious; dicey; droll; eccentric; erratic; fanciful; fantastic; flaky; freakish; funny; quaint; unertain; wagish; playful; animated; blithe; bouncy; cheerful; cheery; effervescent; elastic; fanc.
Source: compiled by the editor from various references; see credits.

Top     

Non-Fiction Usage: Erratic

SubjectTopicQuote

Health

The clinical designations applied to NP are somewhat erratic. (references)

Not infrequently such patients have had erratic treatment and followup programs prior to the onset of chronic renal disease. (references)

Large amounts (several hundred milligrams or more) intensify the user's high, but may also lead to bizarre, erratic, and violent behavior. (references)

Business

This exclusion is the result of erratic market performance over the past several years. (references)

A lack of transparency in the tendering process, erratic behavior by government, and frequent changes in legislation has posed difficulties to investors. (references)

Civil Liberties

Afghanistan

Enforcement of Taliban social strictures was erratic; Taliban edicts generally were enforced in the cities, especially in Kabul, but enforced less consistently in rural areas, in which more discretion was permitted based on local custom. (references)

Economic History

Nepal

Pricing structures in Nepal are erratic. (references)

Rwanda

However, when world coffee prices fell sharply in the 1980s, growth became erratic. (references)

Human Rights

Tunisia

They also claim that erratic court schedules and procedures are designed to deter and discourage observers of political trials. (references)

Political Economy

INDONESIA

The Government of Indonesia's progress on commitments has been erratic and, as a result, Indonesia has only completed three reviews under the program. (references)

Indonesia

Over the next 19 months, however, Wahid faced dissension and opposition within his coalition government, fired two Cabinet Ministers in April 2000, installed a new Cabinet in September 2000, and replaced and switched more Ministers in June and July 2001. His political opponents saw him as increasingly erratic and unable to lead. (references)

Trade

Burma

Supply of such items is erratic, however. (references)

Travel

Pakistan

The water supply is erratic in parts of Karachi, requiring delivery by water tanker to residences in some areas. (references)

Russia

Inclement weather, erratic maintenance and a culture of aggressive driving make road conditions throughout Russia highly variable. (references)

Women

Afghanistan

Implementation remained erratic, but the U.N. and NGO's nonetheless required their female staff to remain at home to avoid open confrontation with the Taliban. (references)

Worker Rights

Thailand

However, implementation of the MOU was erratic, due to insufficient training of law enforcement officials and their unfamiliarity with the law. (references)

Source: compiled by the editor from ICON Group International, Inc.; see credits.

Top     

Usage Frequency: Erratic

"Erratic" is generally used as an adjective (general or positive) -- approximately 100.00% of the time. "Erratic" is used about 402 times out of a sample of 100 million words spoken or written in English. Its rank is based on over 700,000 words used in the English language. Some parts-of-speech are not covered due to the samples used by the British National Corpus. (note: percents less than one-hundredth of one percent have been omitted)
Parts of SpeechPercentUsage per
100 Million Words
Rank in English
Adjective (general or positive)100%40213,930

Source: compiled by the editor from several corpora; see credits.

Top     

Expressions: Erratic

Expressions using "erratic": erratic block Erratic blocks erratic boulder erratic fevers erratic life Erratic phenomena erratic visit glacial erratic. Additional references.

Source: compiled by the editor from various references; see credits.

Top     

Frequency of Internet Keywords: Erratic

The following statistics estimate the number of searches per day across the major English-language search engines as identified by various trade publications. Hyperlinks lead to commercial use of the expression at Amazon.com.
 
ExpressionFrequency
per Day

erratic mouse

8

erratic glacial

6

blood erratic pressure

4

erratic

3

beat erratic heart

3

engine erratic idle

3

blood erratic pressure reading

2

erratic mouse movement

2

diskette drive erratic

2
Source: compiled by the editor from various references; see credits.

Top     

Modern Translations: Erratic

Language Translations for "erratic"; alternative meanings/domain in parentheses.

Albanian

  

i parregullt (abnormal, inconsistent, incorrect, irregular, out), i hallakatur (discursive, errant, hugger mugger, rambling, scatterbrained), i çuditshëm (bizarre, cranky, curious, dark, eccentric, electric, extraordinary, fanciful, fantastic, fantastical, frabjous, freak, freakish, funny, grotesque, kinky, odd, oddish, off beat, outlandish, peculiar, pixilated, puzzling, quaint, queer, quizzical, rummy, strange, surprising, uncanny, unco, unnatural, unusual, viewy, way out, weird, whimsical), i çrregullt (anomalous, disorderly, fitful, formless, irregular, messy, tumultuary, unkempt, untidy), i çoroditur (addle-brained, addle-pated, anile, haywire, perverse). (various references)

   

Arabic 

  

‏مجروف, ‏غير منظم (amorphous, patchy, ragged, rough, unorganized), ‏ضال (aberrant, astray, errata, lost, rogue, stray, wandering), ‏صخر مجروف, ‏شخص غريب الأطوار (codger, crack, curious, eccentric, quiz), ‏شاذ (aberrant, anomalous, atypical, bastard, bizarre, eccentric, exotic, extraordinary, extravagant, far fetched, freak, intriguing, irregular, monstrous, moonstruck, odd, off beat, outlandish, preternatural, prodigious, queer, rogue, scatty, singular, stupendous, thumping, wild), ‏شارد (errant, inattentive, runaway, scampish, stray). (various references)

   

Bulgarian 

  

скитник (bum, casual, derelict, drifter, floater, hobo, itinerant, knockabout, land-loper, land-louper, nomad, on the wallaby, roadster, roamer, rover, runabout, straggler, swagman, tramp, vagabond, vagrant, wanderer), капризен (capricious, faddish, fanciful, fantastic, fantastical, fastidious, fickle, fractious, freakish, freaky, fretful, ill, inconstant, maggoty, particular, petulant, skittish, tricksy, vagarious, vagrant, wayward, whimsical), особняк (card, crank, freak, oddity, original), непостоянен (astatic, capricious, casual, changeable, changeful, discontinuous, fickle, fluctuating, fluid, impermanent, inconstant, irregular, liquid, lubricous, mobile, mutable, non-persistent, seesaw, sporadic, streaky, uncertain, unequable, uneven, unreliable, unstable, unsteady, vagarious, variable, variant, volatile, wayward, whimsical, yo-yo), ератичен, безотговорен (carefree, happy go lucky, harum scarum, irresponsible, shiftless, unconscionable, wildcat, worthless), блуждаещ (errant, excursive, faraway, planetary, vacant, vagrant), променлив (baffling, changeable, choppy, fitful, fluctuating, fluent, inconsistent, inconstant, liquid, mobile, protean, shifting, undecided, unsettled, unstable, unsteady, variable, variant, varied, versatile, volatile), изменчив (variable, volatile), довлечен от ледник. (various references)

   

Chinese 

  

古怪 (Erratical, Excentric, kooky, Quirky, Quizzical, Weird, Weirdness). (various references)

   

Czech

  

vrtošivý (fanciful, incalculable, temperamental, wayward), nevyrovnaný (uneven, unpaid, unsettled), nestálý (changeable, fickle, floating, impermanent, inconstant, passing, unceasing, unsettled, unstable, unsteady, volatile), nepravidelný (irregular, ragged, unequal, uneven, unsteady), náladový (capricious, crotchety, freakish, Moody, temperamental, whimsical), kolísavý (fluctuating, jumpy, unstable, wavering), bloudící (aberrant). (various references)

   

Danish

  

erratisk blok (erratic block, erratic boulder, glacial erratic, stray block), erratisk, vandrende (garland, migrating, water garland), vandreblok (erratic block, erratic boulder, glacial erratic, stray block). (various references)

   

Dutch

  

erratisch, erraticus, zwerfsteen (erratic block, erratic boulder, glacial erratic, stray block), zwerfkei (erratic block, erratic boulder, glacial erratic, stray block). (various references)

   

Farsi 

  

متلون (Changeable, Protean), نامنظم (Acrostic), غیرمعقول (Extravagant, Unconscionable), غیرقابل پیش بینی , سرگردان (Adrift, Astray, Discursive, Gadabout, Rambler, Strafe, Straggle, Stray, Wanderer), دمدمی مزاج (Capricious, Cyclothyme, Pliant). (various references)

   

Finnish

  

siirtolohkare (boulder, cobble, erratic block, erratic boulder, glacial erratic, pebble, stray block). (various references)

   

French

  

erratique. (various references)

   

German

  

erratisch. (various references)

   

Greek 

  

πλάνης λίθος (erratic block, erratic boulder, glacial erratic, stray block), πλανόδιοσ (errant, itinerant, peripatetic), εκκεντρικόσ (aberrational, bizarre, crackpot, cranky, eccentric, fogey, fogy, notional, pixilated, screw-ball, wacky, weirdie), ασταθήσ (choppy, inconstant, infirm, top heavy, tottering, tottery, unstable, unsteady, wabbly), αλλοπρόσαλλοσ. (various references)

   

Hebrew 

  

יוצא "ופן (eccentric, exceptional, exotic, extraordinary, irregular, maverick, signal, singular, unusual), בלתי יציב (unstable). (various references)

   

Hungarian

  

akadozó, szeszélyes (be capricious, capricious, changeful, fanciful, fickle, fitful, freakish, have a little finger ache, have moods, kinky, maggoty, mercurial, moody, peevish, petulant, skittish, wanton, whimsical), rendetlen (cluttered, deranged, dingy, disorderly, flipperty-flopperty, higgledy-piggledy, messy, pell mell, ragged, rooky, slipshod, sloppy, slovenly, snuffy, straggly, tumultuous, unkempt, untidy), kiszámíthatatlan (imponderable, incalculable, unpredictable, wacky). (various references)

   

Indonesian

  

tak menentu (chancy, touch and go). (various references)

   

Italian

  

erratico. (various references)

   

Japanese Kanji 

  

突飛 (extraordinary, offbeat, wild). (various references)

   

Japanese Katakana 

  

とっぴ (extraordinary, offbeat, wild). (various references)

   

Korean 

  

불규칙 (Erratical). (various references)

   

Manx

  

corragh (chequered, chequered as career, crazy, eccentric, falling, hectic, infirm, irresolute, jerry-built, rocky place, sensitive, skittish, troubled, troubled of period, unbalanced, unbalanced of mind, uneven, uneven as temper, wobbly). (various references)

   

Norwegian

  

ujevn, uberegnelig. (various references)

   

Pig Latin

  

erraticay

   

Portuguese

  

errático. (various references)

   

Romanian

  

eratic, nesigur (chancy, conjectural, doubtful, dubious, fitful, hesitating, in doubt, inconstant, indecisive, insecure, irresolutely, rocky, ticklish, uncertain, unsafe), neregulat (broken, disorderly, fitful, irregular, irregularly, odd, patchy, ragged, rugged, scraggy, snatchy, unequal, uneven), neconstant, intermitent (discontinuous, intermittent, intermittently, jerkily, jerky, remittent), inegal (matchlessly, unequable, unequal, unequally, uneven), dezordonat (dishevelled, disorderly, ill-regulated, irregular, messy, riotous, slipshod, unkempt, untidy). (various references)

   

Russian 

  

сумасбродный (daffy, madcap, screwy), отклоняющийся от нормы (abnormal), неустойчивый (astable, changeable, dicky, grog, groggy, inconstant, infirm, labile, ramshackle, top heavy, topheavy, unballasted, unequable, unstable, unsteady, waggly, wavering, yielding), неуверенный (insecure of, unassured, uncertain, unsure), беспорядочный (chaotic, disorderly, haywire, higgledy-piggledy, hugger mugger, indiscriminate, inordinate, messy, pell mell, rambling, random, rough and tumble, shambolic, topsy turvy, tumultuary, tumultuous, undigested, unregulated, upside down). (various references)

   

Serbo-Croatian

  

nestalan (changeable, fickle, fleeting, impermanent, inconsistent, inconstant, mercurial, shifty, skittish, transient, unabiding, unsteady, versatile, volatile, voluble), nepravilan (erroneous, irregular, unlawful, wrong). (various references)

   

Spanish

  

errático. (various references)

   

Swedish

  

oregelbunden (abnormal, anomalous, fitful, intermittent, irregular, snatchy, unequal, unsteady), flyttblock (boulder, bowlder, erratic block, erratic boulder, glacial erratic, nodule, stray block). (various references)

   

Thai

  

ไม่แน่ไม่นอน, คนที่เอาแน่ไม่ไ"้. (various references)

   

Turkish

  

tuhaf (antic, bizarre, comical, cranky, curious, droll, flaky, funnily, funny, funny peculiar, laughable, odd, offbeat, peculiar, peregrine, queer, quizzical, rum, rummy, screwball, screwy, singular, splay, strange, twee, unaccustomed, uncouth, unusual, weird, whimsical), kararsız (ambivalent, astatic, baffling, changeable, changeful, double-minded, doubtful, dubious, faltering, fickle, flighty, fluctuating, flukey, fluky, fluxional, halting, hazy, hesitant, inconsistent, inconstant, indecisive, infirm, infirm of purpose, irresolute, precarious, restless, shilly shally, uncertain, uncommitted, undecided, undetermined, unresolved, unsettled, unstable, unsteady, vacillating, vagabond, vague, wayward, weak-kneed), gezen, değişken (capricious, changeable, changeful, choppy, factor, fickle, fitful, flexible, flexile, fluid, fluxional, incalculable, inconsistent, inconstant, inequable, labile, mercurial, mobile, mutable, protean, shifting, sliding, streaked, streaky, swinging, uncertain, unfunded, unstable, unsteady, variable, variant, versatile), düzensiz (chaotic, desultory, disordered, disorderly, disorganized, excursive, fitful, freehand, haywire, hugger mugger, huggermugger, indigested, inordinate, irregular, jerky, nonuniform, non-uniform, out of order, out of square, out of trim, out-of-balance, patchily, patchy, ragged, rambling, snatchy, snuffy, unequal, unkempt, unsteady, untidy). (various references)

   

Ukranian 

  

чудний (antic, bizarre, droll, funny, odd, oddball, oddish, outlandish, singular, strange), нестійкий (astatic, broken, catching, chancy, dicky, drunk, groggy, infirm, labile, non-persistent, non-resistant, quaky, sliding, staggering, tickle, top heavy, unbalanced, unfixed, unsettled, unsteady, wambly, yielding), неуважний (absent, absentminded, abstracted, careless, distrait, faraway, forgetful, inadvertent, inattentive, inconsiderate, incurious, inobservant, mused, neglectful, negligent, oblivious, oscitant, outward, unmindful, vague). (various references)

   

Vietnamese 

  

thất thường (arbitrary, capricious, casual, erratically, fit, start), người bạ đâu hay đấy, người được chăng hay chớ, được chăng hay chớ (erratically, hit-or-mis). (various references)

Source: compiled by the editor from various translation references.

Top     

Derivations & Misspellings: Erratic

Derivations

Words beginning with "erratic": erratical, erratically, erraticism, erraticisms, erratics. (additional references)


Misspellings

"Erratic" is suggested in spellcheckers for the following: ecratic, ecrratic, Elrathia, eratic, erattic, eravi, erractic, erradic, erratas, errate, erratica, erratics, erraticz, erratuc, errotic, errratic, ferritic, iratic, irratic, merpati, Urrutia. (additional references)

Source: compiled by the editor, based on several corpora (additional references).

Top     

Rhyming with "Erratic"

# of Phoneme MatchesPronunciationWord(s) rhyming with "erratic" (pronounced ira"tik)
5-r a" t i karistocratic, autocratic, bureaucratic, democratic, idiosyncratic, technocratic, theocratic, undemocratic.
4-a" t i kacrobatic, aerobatic, aromatic, asthmatic, asymptomatic, attic, automatic, axiomatic, charismatic, cinematic, climatic, diagrammatic, diplomatic, dogmatic, dramatic, ecstatic, electrostatic, emblematic, emphatic, enigmatic, enzymatic, fanatic, hepatic, homeostatic, idiomatic, lymphatic, mathematic, melodramatic, monochromatic, numismatic, operatic, pancreatic, phosphatic, pneumatic, posttraumatic, pragmatic, prismatic, problematic, programmatic, prostatic, psychosomatic, rheumatic, schematic, semiautomatic, static, symptomatic, systematic, thematic, traumatic, undiplomatic.
3-t i kacetic, acoustic, aesthetic, agnostic, alphabetic, altruistic, amniotic, anachronistic, analytic, anesthetic, antagonistic, Antarctic, antibiotic, antic, anticlimactic, antiseptic, aortic, apathetic, apocalyptic, apologetic, apoplectic, aquatic, arctic, arithmetic, arthritic, artistic, ascetic, astronautic, atavistic, atheistic, athletic, authentic, autistic, ballistic, bombastic, capitalistic, catalytic, cathartic, caustic, chaotic, characteristic, chauvinistic, chiropractic, climactic, coloristic, cosmetic, critic, cryptic, cultic, cystic, dendritic, despotic, deterministic, diabetic, diagnostic, dialectic, diamagnetic, didactic, dietetic, diuretic, domestic, drastic, drumstick, dualistic, dynastic, ecclesiastic, eclectic, ecliptic, elastic, electrolytic, electromagnetic, emetic, empathetic, energetic, enthusiastic, epigenetic, epileptic, erotic, euphemistic, evangelistic, exotic, expressionistic, extragalactic, fantastic, fatalistic, ferromagnetic, feudalistic, fiberoptic, frantic, frenetic, futuristic, galactic, genetic, geomagnetic, gigantic, granitic, gymnastic, halophytic, hectic, hedonistic, hemolytic, heretic, hermaphroditic, holistic, homiletic, humanistic, hyperkinetic, hypnotic, iconoclastic, idealistic, idiotic, imperialistic, impressionistic, individualistic, inelastic, interscholastic, jingoistic, journalistic, kinesthetic, kinetic, lactic, legalistic, linguistic, logistic, magnetic, majestic, masochistic, materialistic, mechanistic, militaristic, monastic, monopolistic, moralistic, mystic, narcissistic, narcotic, nationalistic, naturalistic, neritic, neurotic, novelistic, oligopolistic, onomastic, opportunistic, optic, optimistic, orthodontic, pantheistic, paralytic, paramagnetic, parasitic, parasympathetic, parthenogenetic, paternalistic, pathetic, patriotic, patristic, pectic, pedantic, peptic, peripatetic, pessimistic, phonetic, plastic, pluralistic, poetic, polytheistic, porphyritic, primitivistic, propagandistic, prophetic, prophylactic, prosthetic, psychoanalytic, psychotherapeutic, psychotic, puristic, quixotic, realistic, relativistic, ritualistic, robotic, romantic, rustic, sadistic, sarcastic, scholastic, semantic, semiotic, sensationalistic, septic, simplistic, skeptic, socialistic, statistic, stylistic, surrealistic, sycophantic, symbiotic, sympathetic, synergistic, synthetic, tactic, terroristic, therapeutic, thermoplastic, thrombolytic, transatlantic, triptych, unapologetic, unauthentic, uncharacteristic, unenthusiastic, unpatriotic, unrealistic, unsympathetic, voyeuristic.

Source: compiled by the editor (additional references); see credits.

Top     

Anagrams: Erratic

.

.

Scrabble® Enable2K-Verified Anagrams

Direct Anagrams: cirrate.

Words within the letters "a-c-e-i-r-r-t"

-1 letter: artier, carter, crater, irater, racier, tracer.

-2 letters: airer, areic, carer, caret, carte, cater, ceria, citer, crate, crier, erica, irate, racer, rater, react, recta, recti, retia, ricer, tarre, terai, terra, trace, triac, trice, trier.

-3 letters: acre, airt, care, carr, cart, cate, cire, cite, etic, race, rare, rate, rear, rice, rite, tace, tare, tear, tier.

 Words containing the letters "a-c-e-i-r-r-t"
 

+1 letter: catbrier, craftier, criteria, erratics.

 

+2 letters: artificer, careerist, carrotier, cartridge, catbriers, certainer, charriest, cratering, curtailer, erratical, geriatric, oratrices, practicer, racketier, recrating, rectorial, reticular, retracing, rubricate, scarriest, starchier, tarriance, terracing, traceried, traceries, trierarch.

 

+3 letters: architrave, archpriest, artificers, barometric, bioreactor, careerists, caricature, carritches, carrotiest, cartridges, catarrhine, certiorari, charioteer, chartering, contraries, craterlike, crematoria, curtailers, diarrhetic, eradicator, erraticism, fratricide, geriatrics, haircutter, meritocrat, parametric, parritches, practicers, reaccredit, recharting, recreating, recreation, recreative, refractile, refracting, refraction, refractive, replicator, retracking, retractile, retracting, retraction, rhetorical, rubricated, rubricates, scratchier, tarriances, tetrameric, tetrarchic, trafficker, transcribe, triarchies, trierarchs, trierarchy, trifurcate.

Source: compiled by the editor from various references; see credits.

SCRABBLE® is a registered trademark. All intellectual property rights in and to the game are owned in the U.S.A and Canada by Hasbro Inc., and throughout the rest of the world by J.W. Spear & Sons Limited of Maidenhead, Berkshire, England, a subsidiary of Mattel Inc. Mattel and Spear are not affiliated with Hasbro.

Top     

Alternative Orthography: Erratic


Hexadecimal (or equivalents, 770AD-1900s) (references)

45 72 72 61 74 69 63

Leonardo da Vinci (1452-1519; backwards) (references)

American Sign Language (origins from 1620-1817 in Italy and, especially, France) (references)

=

Semaphore (1791, in France) (references)

Braille (1829, in France) (references)

Morse Code (1836) (references)

.    .-.    .-.    .-    -    ..    -.-.

Dancing Men (Sir Arthur Conan Doyle, 1903) (references)

Binary Code (1918-1938, probably earlier) (references)

01000101 01110010 01110010 01100001 01110100 01101001 01100011

HTML Code (1990) (references)

&#69 &#114 &#114 &#97 &#116 &#105 &#99

ISO 10646 (1991-1993) (references)

0045 0072 0072 0061 0074 0069 0063

British Sign Language (Fingerspelling, BSL; 1992, British Deaf Association Dictionary of British Sign Language) (references)

Encryption (beginner's substitution cypher): (references)

39848467867569

Top     

 

INDEX

1. Definition
2. Synonyms
3. Crosswords
4. Usage: Commercial
5. Images: Photo Album
6. Sounds
7. Quotations: Non-fiction
8. Usage Frequency
9. Expressions
10. Expressions: Internet
11. Translations: Modern
12. Derivations
13. Rhymes
14. Anagrams
15. Orthography
16. Bibliography


  

Copyright © Philip M. Parker, INSEAD. Terms of Use.